What are rare reasons for shortness of breath?

Rare causes of shortness of breath (dyspnea) include rare lung diseases like autoimmune pulmonary alveolar proteinosis (aPAP) or chronic beryllium disease, genetic disorders such as Alpha-1 Antitrypsin Deficiency, certain systemic conditions like lupus, rheumatoid arthritis, or scleroderma, metabolic issues like diabetic ketoacidosis, neurological disorders affecting breathing muscles, and even severe anaphylaxis, all disrupting normal oxygen exchange or respiratory mechanics.

Takedown request   |   View complete answer on nhsinform.scot

What causes shortness of breath in children?

Shortness of breath has many causes. Sometimes conditions such as anxiety can lead to shortness of breath. Some children get mild shortness of breath when they exercise. Trouble breathing also can be a symptom of a serious problem, such as asthma, lung disease, heart problems, and pneumonia.

Takedown request   |   View complete answer on myhealth.alberta.ca

Can shortness of breath cause vomiting?

Get emergency medical care if you experience shortness of breath that: Began suddenly and affects your ability to function. Is accompanied by chest pain that lasts more than a few minutes. Is accompanied by dizziness, fainting, nausea or vomiting.

Takedown request   |   View complete answer on mayoclinic.org

When to worry about shortness of breath during pregnancy?

You should worry about shortness of breath in pregnancy if it's sudden, severe, worsening, or comes with chest pain, heart palpitations, dizziness, fever, blue lips/fingers, coughing blood, wheezing, severe nausea, or trouble talking and breathing, as these signal potential serious issues like anemia, asthma, or clots, requiring immediate medical attention. 

Takedown request   |   View complete answer on cdc.gov

What can cause unexplained shortness of breath?

  • Anaphylaxis.
  • Asthma.
  • Blocked airways.
  • Blood loss that happens suddenly.
  • Carbon monoxide poisoning.
  • COPD.
  • Coronavirus disease 2019 (COVID-19)
  • Fluid buildup around the heart, called cardiac tamponade.

Takedown request   |   View complete answer on mayoclinic.org

The 7 Causes of Shortness of Breath – Dr.Berg on Breathing Problems

32 related questions found

How do I tell if my shortness of breath is serious?

Shortness of breath (SOB) is serious and requires immediate emergency care if it's sudden, severe, or accompanied by chest pain, dizziness, fainting, blue lips/nails, confusion, or inability to speak in full sentences; it can signal heart or lung emergencies like heart attack, pulmonary embolism, or severe asthma, so seek help if you have trouble breathing at rest, feel sick, cough up blood, or experience worsening chronic SOB.
 

Takedown request   |   View complete answer on my.clevelandclinic.org

What can shortness of breath be mistaken for?

Shortness of breath is often a symptom of heart and lung problems. But it can also be a sign of other conditions like asthma, allergies or anxiety. Intense exercise or having a cold can also make you feel breathless.

Takedown request   |   View complete answer on my.clevelandclinic.org

Can anemia cause shortness of breath?

Overview. Anemia is a problem of not having enough healthy red blood cells or hemoglobin to carry oxygen to the body's tissues. Hemoglobin is a protein found in red cells that carries oxygen from the lungs to all other organs in the body. Having anemia can cause tiredness, weakness and shortness of breath.

Takedown request   |   View complete answer on mayoclinic.org

What are 5 warning signs that might indicate complications during pregnancy?

Five key warning signs during pregnancy needing immediate medical attention include vaginal bleeding, severe headaches with vision changes, decreased baby movement, severe abdominal pain/cramping, and signs of preterm labor like regular contractions or fluid leakage, as these can signal serious issues like miscarriage, preeclampsia, placental problems, or infection. Always contact your healthcare provider or seek emergency care for these symptoms.
 

Takedown request   |   View complete answer on ncbi.nlm.nih.gov

What are the early symptoms of twin pregnancy?

What are twin pregnancy symptoms?

  • Breast tenderness.
  • Fatigue.
  • Frequent urination.
  • Increased appetite.
  • Morning sickness.

Takedown request   |   View complete answer on my.clevelandclinic.org

What sickness starts with shortness of breath?

Many conditions can cause chronic shortness of breath including: Chronic lung diseases, including COPD, asthma, pulmonary fibrosis and pulmonary hypertension. Heart disease or congestive heart failure.

Takedown request   |   View complete answer on lung.org

What is cardiogenic vomiting?

This causes a phenomenon called cardiogenic vomiting, where patients experience nausea and vomiting induced by the toxins released as injured cardiomyocytes, the cells that comprise heart tissue, begin to die.

Takedown request   |   View complete answer on gohealthuc.com

What are the first warning signs of pneumonia?

Early signs of pneumonia often mimic the flu or a bad cold but worsen, including fever, cough (which might bring up phlegm), fatigue, shortness of breath, and chest pain that worsens with breathing or coughing; other common symptoms are chills, headache, muscle aches, loss of appetite, and sometimes vomiting or diarrhea, with confusion possible in older adults, while infants show fussiness, trouble feeding, and pale skin.
 

Takedown request   |   View complete answer on lung.org

What are the red flags for shortness of breath?

you feel sick or are being sick. you're coughing up blood. you have pain or swelling in 1 of your legs. you have heart palpitations – this may feel like your heart is racing, going too slowly or skipping a beat or like a fluttering feeling in your chest.

Takedown request   |   View complete answer on nhs.uk

When to take a child to the ER for shortness of breath?

Visit the pediatric ER if you notice these symptoms:

  1. Breathing that is faster than normal.
  2. Breathing harder than usual without exertion.
  3. Chest and abdomen look like a see-saw (one goes up while the other goes down)
  4. Bluish hue to the lips or skin.
  5. Persistent barking cough or wheezing.

Takedown request   |   View complete answer on wesleymc.com

What are the four types of breathing?

What are the types of breathing?

  • Eupnea. Eupnea is normal breathing. ...
  • Hyperpnea. Hyperpnea is intensive, deep breathing. ...
  • Diaphragmatic breathing. Diaphragmatic breathing is a type of breathing in which you consciously use your diaphragm to help you take deep breaths.
  • Costal.

Takedown request   |   View complete answer on my.clevelandclinic.org

What are signs of ectopic pregnancy?

Main symptoms

  • Vaginal bleeding. Vaginal bleeding tends to be a bit different to your regular period. ...
  • Tummy pain. You may experience tummy pain, typically low down on one side. ...
  • Shoulder tip pain. Shoulder tip pain is an unusual pain felt where your shoulder ends and your arm begins. ...
  • Discomfort when going to the toilet.

Takedown request   |   View complete answer on nhs.uk

What are maternal danger signs?

If any of the following signs occur, the woman should be taken immediately to the hospital or health centre.

  • vaginal bleeding.
  • convulsions/fits.
  • severe headaches with blurred vision.
  • fever and too weak to get out of bed.
  • severe abdominal pain.
  • fast or difficult breathing.

Takedown request   |   View complete answer on ncbi.nlm.nih.gov

What vitamin deficiency causes shortness of breath?

Most symptoms are the same whether they are caused by either folate deficiency or vitamin B12 deficiency. Symptoms of vitamin B12 and folate deficiency anaemia include: rapid breathing or shortness of breath.

Takedown request   |   View complete answer on nhs.uk

What are signs of low iron?

Iron deficiency symptoms include fatigue, pale skin, shortness of breath, cold hands/feet, brittle nails, headaches, and unusual cravings like ice (pica), stemming from reduced oxygen in the body, affecting energy and physical appearance. Other signs can involve a sore tongue, hair loss, rapid heartbeat, and poor concentration.
 

Takedown request   |   View complete answer on mayoclinic.org

What is a red flag for anemia?

Warning signs of anemia you shouldn't ignore

Weakness. Dizziness. Shortness of breath. Irregular heartbeat.

Takedown request   |   View complete answer on primarycarewalkinmedicalclinic.com

What illnesses start with shortness of breath?

What causes shortness of breath?

  • lung problems, such as asthma, chronic obstructive pulmonary disease (COPD) or lung cancer.
  • heart problems, such as a heart attack or heart failure.
  • infections of your airways, such as croup, bronchitis, pneumonia, COVID-19, flu or even a cold.
  • a panic attack or anxiety.
  • allergic reactions.

Takedown request   |   View complete answer on healthdirect.gov.au

What is false shortness of breath?

Psychogenic breathlessness or pseudo-dyspnea is a condition where the patient suffers from shortness of breath from time to time. This disease is often confused with a similar breathing disorder called Chronic Dyspnea.

Takedown request   |   View complete answer on lybrate.com

What tests are done for shortness of breath?

After doing a physical exam and listening to your heart and lungs, your healthcare provider may order additional tests. These tests and procedures may include blood tests, imaging tests such as a chest X-ray or CT scan, lung function tests like spirometry or an echocardiogram.

Takedown request   |   View complete answer on lung.org