What is the number one symptom of anemia?

The number one symptom of anemia, particularly iron deficiency anemia, is fatigue or extreme tiredness, often accompanied by weakness, because the blood can't deliver enough oxygen to your body. Other common signs include pale skin, shortness of breath, dizziness, cold hands and feet, and headaches, but fatigue is usually the most noticeable and common initial indicator.

Takedown request   |   View complete answer on nhlbi.nih.gov

What are the worst symptoms of anemia?

Possible symptoms of anemia include:

  • Tiredness.
  • Weakness.
  • Shortness of breath.
  • Pale or yellowish skin, which might be more obvious on white skin than on Black or brown skin.
  • Irregular heartbeat.
  • Dizziness or lightheadedness.
  • Chest pain.
  • Cold hands and feet.

Takedown request   |   View complete answer on mayoclinic.org

Can anemia cause swelling?

Signs and symptoms of iron deficiency may include brittle nails, swelling or soreness of the tongue, cracks in the sides of the mouth, an enlarged spleen, and frequent infections. People who have iron-deficiency anemia may have an unusual craving for nonfood items, such as ice, dirt, paint, or starch.

Takedown request   |   View complete answer on hoacny.com

Can anemia cause a rash?

People with iron deficiency anemia may experience itchy skin (pruritus) that can become red, bumpy and sore when scratched. Rashes associated with aplastic anemia usually appear as tiny red or purple dots under your skin (petechiae).

Takedown request   |   View complete answer on my.clevelandclinic.org

Can anemia cause dizziness?

And when you don't have enough hemoglobin, your blood can't carry oxygen throughout your body. As a result, you might feel tired. You may notice pale skin and cold hands and feet. Iron-deficiency anemia can also make you feel dizzy or lightheaded.

Takedown request   |   View complete answer on my.clevelandclinic.org

Anemia, Causes, Signs and Symptoms, Diagnosis and Treatment

15 related questions found

How does anemia make your head feel?

When your brain doesn't get enough oxygen from the blood, it can trigger headaches. The headaches may be dull and constant or come and go. Shortness of Breath: You may notice yourself feeling winded or short of breath easily with anemia.

Takedown request   |   View complete answer on ondemand.labcorp.com

What deficiency causes you to feel off balance?

People need vitamin B-12 for the brain to work well. If not treated, vitamin B-12 deficiency can lead to issues with the nerves, brain or spinal cord. These might include lasting tingling in the hands and feet or trouble with balance.

Takedown request   |   View complete answer on mayoclinic.org

What is a red flag for anemia?

Warning signs of anemia you shouldn't ignore

Weakness. Dizziness. Shortness of breath. Irregular heartbeat.

Takedown request   |   View complete answer on primarycarewalkinmedicalclinic.com

What deficiency causes itching all over the body?

Itching (pruritus) in the body can stem from several nutrient deficiencies, with iron deficiency anemia being a common culprit, causing dry, itchy skin. Other potential deficiencies linked to itching include vitamin D, essential fatty acids, B vitamins (like B12), and minerals like calcium, zinc, and copper, affecting skin health, hydration, and histamine regulation. 

Takedown request   |   View complete answer on vinmec.com

Can anemia affect your nails?

Iron deficiency can weaken the nails, making them more prone to splitting, breaking, or becoming brittle. Pale or white nail beds: Normal toenail beds should be pink. In severe cases of IDA, the nail beds may appear pale or even white due to reduced blood flow and oxygenation.

Takedown request   |   View complete answer on lighthousefootandankle.com

Can anemia cause a big tummy?

Anemia can slow down the metabolic rate in some cases. A slower metabolism can contribute to weight gain, while a faster metabolism can lead to weight loss.

Takedown request   |   View complete answer on megawecare.com

When to go to the ER for anemia?

Anemia may increase your risk of a heart attack. Call 911 if you have the following symptoms: Chest pain. Shortness of breath or trouble breathing.

Takedown request   |   View complete answer on my.clevelandclinic.org

What are the weird symptoms of iron deficiency?

Less common symptoms of iron deficiency anaemia (that are not usually connected to pregnancy) include:

  • hearing ringing, buzzing or hissing noises inside your head (tinnitus)
  • food tasting strange.
  • feeling itchy.
  • a sore tongue.
  • hair loss – you notice more hair coming out when brushing or washing it.

Takedown request   |   View complete answer on nhs.uk

How ill do you feel with anemia?

Symptoms of iron-deficiency anemia may include: Being pale or having yellow "sallow" skin. Unexplained fatigue or lack of energy. Shortness of breath or chest pain, especially with activity.

Takedown request   |   View complete answer on hematology.org

How to tell if your anemia is getting worse?

As the anemia gets worse, symptoms may include:

  1. Brittle nails.
  2. Blue color to the whites of the eye.
  3. Desire to eat ice or other non-food things (pica)
  4. Feeling lightheaded when you stand up.
  5. Pale skin color.
  6. Shortness of breath.
  7. Sore or inflamed tongue.
  8. Mouth ulcers.

Takedown request   |   View complete answer on ufhealth.org

Can anemia cause joint pain?

Oxygen deficiency: A low red blood cell count means less oxygen is delivered, leading to muscle and joint fatigue. Tissue damage: Lack of oxygen can cause tissue inflammation and pain. Reduced blood flow: Anemia can limit the delivery of nutrients to muscles and joints, increasing stiffness.

Takedown request   |   View complete answer on insidetracker.com

What organ problems cause itchy skin?

What other conditions can cause itchy skin?

  • Diabetes.
  • Chronic kidney failure.
  • Liver disease.
  • HIV infection.
  • Allergic reactions to food, medicine and insect bites.
  • Thyroid disorders.
  • Multiple sclerosis.
  • Anxiety.

Takedown request   |   View complete answer on mdanderson.org

Which vitamin stops itching?

The results suggest that vitamin D supplementation, especially in its D3 form, may significantly reduce the severity of chronic pruritus.

Takedown request   |   View complete answer on pmc.ncbi.nlm.nih.gov

What cancer is anemia a symptom of?

Types of Cancer that Cause Anemia

  • Leukemia.
  • Lymphoma.
  • Myeloma.
  • Lung cancer.
  • Breast cancer.
  • Colorectal cancer.
  • Kidney cancer.
  • Cervical cancer.

Takedown request   |   View complete answer on patientpower.info

Do people with anemia sleep a lot?

Research suggests that having anemia tends to make people sleep less, not more. The tendency to sleep less is associated with both iron-deficiency anemia and non-iron-deficiency anemia and has been found to occur in people of all ages, including infants, children, adults, and older adults.

Takedown request   |   View complete answer on sleepfoundation.org

What do you crave when your B12 is low?

B12 deficiency can trigger specific food cravings, most notably for meat, fish, or eggs, as the body seeks animal-based sources to replenish the vitamin, especially in those on vegetarian/vegan diets or older adults. While cravings for sugary or salty foods can also signal general B-vitamin issues, the distinct urge for protein-rich animal products is a key indicator, but professional testing is crucial for confirmation. 

Takedown request   |   View complete answer on pmc.ncbi.nlm.nih.gov

Why do I feel unsteady when I walk?

Loss of balance or unsteadiness

Losing your balance while walking, or feeling imbalanced, can result from: Vestibular problems. Abnormalities in your inner ear can cause a sensation of a floating or heavy head and unsteadiness in the dark. Nerve damage to your legs (peripheral neuropathy).

Takedown request   |   View complete answer on mayoclinic.org

What deficiency causes leg pain at night?

Both low vitamin D and calcium lead to increased muscle cramps. Vitamin B1 is also called thiamine. Your body uses it to produce energy. Low vitamin B1 can lead to a condition called beriberi, which causes leg pain and cramps.

Takedown request   |   View complete answer on goodrx.com