Can low iron cause weight gain?

Iron deficiency doesn't directly cause weight gain, but its symptoms like fatigue and low energy lead to less activity, slowing metabolism and hindering fat burning, which can result in weight gain; it can also impact thyroid function, another cause of weight gain, while sometimes the deficiency itself can cause appetite changes.

Takedown request   |   View complete answer on goodrx.com

What are the weird symptoms of iron deficiency?

Less common symptoms of iron deficiency anaemia (that are not usually connected to pregnancy) include:

  • hearing ringing, buzzing or hissing noises inside your head (tinnitus)
  • food tasting strange.
  • feeling itchy.
  • a sore tongue.
  • hair loss – you notice more hair coming out when brushing or washing it.

Takedown request   |   View complete answer on nhs.uk

Why do I gain weight when my iron is low?

One way iron deficiency anaemia can impact your weight is through thyroid function and metabolism [10]. Your thyroid hormone and metabolism are responsible for helping your body burn calories, so naturally, if they are underactive, this can lead to weight gain.

Takedown request   |   View complete answer on kinfertility.com.au

Can iron pills cause headaches?

Headache. Inadequate iron levels can sometimes lead to headaches, making it a cruel irony that some people also experience headaches from taking iron tablets. Luckily, this is a rare side effect.

Takedown request   |   View complete answer on activeiron.com

Can anemia cause a big tummy?

Anemia can slow down the metabolic rate in some cases. A slower metabolism can contribute to weight gain, while a faster metabolism can lead to weight loss.

Takedown request   |   View complete answer on megawecare.com

Anemia (low iron) can prevent you from losing weight!!

39 related questions found

Is it harder to lose weight with low iron?

Without enough iron, your body can't efficiently carry oxygen to tissues, which impairs energy, stamina, and recovery. Energy & metabolism – Low iron often leads to fatigue, weakness, and shortness of breath even with light exertion. That makes exercise and daily activities harder, which can slow your weight loss.

Takedown request   |   View complete answer on transitionsalem.com

What are bad signs of anemia?

As anemia worsens, symptoms may escalate to include:

  • Feeling dizzy or lightheaded.
  • Blue discoloration in the whites of the eyes.
  • Brittle nails.
  • Pale or yellowing skin, resembling jaundice.
  • Loss of libido.
  • A desire to eat non-food items (pica syndrome)
  • An inflamed or sore tongue.
  • Mouth ulcers.

Takedown request   |   View complete answer on pennmedicine.org

Do iron pills work immediately?

Oral iron supplements usually start working in about 3 to 7 days. Symptoms of iron deficiency should start to improve after 2 to 4 weeks of supplementation, but your hemoglobin levels could take up to 2 months to return to normal. Common side effects of iron supplements include constipation, nausea, and stomach pain.

Takedown request   |   View complete answer on goodrx.com

What else can cause low iron levels?

Common causes include heavy menstrual periods, regular blood donation, regular nosebleeds, other chronic conditions that involve bleeding (such as peptic ulcers, polyps or cancers in the large intestine), and certain medications, particularly aspirin.

Takedown request   |   View complete answer on betterhealth.vic.gov.au

What is the most common side effect of iron?

The most common side effects are gastrointestinal, such as nausea/vomiting, constipation or diarrhea, flatulence, metallic taste, staining of the teeth, or epigastric distress. Patients may feel uncomfortable with the change in stool caliber and color to green or 'tarry black.

Takedown request   |   View complete answer on ncbi.nlm.nih.gov

Can low iron affect sleep?

Iron deficiency (ID) has received increasing attention in disorders affecting sleep and wake behaviors. ID has been shown to be associated not only with RLS/PLMs [14] and arousal disorders like parasomnias [15], but also in sleep disordered breathing (SDB) [16], RSD, and in pediatric ADHD [17].

Takedown request   |   View complete answer on sciencedirect.com

What can cause rapid weight gain?

Bloating, or swelling due to a buildup of fluid in the tissues can cause weight gain. This may be due to menstruation, heart or kidney failure, preeclampsia, or medicines you take. A rapid weight gain may be a sign of dangerous fluid retention. If you quit smoking, you might gain weight.

Takedown request   |   View complete answer on ufhealth.org

Can low iron make you hungry?

Iron-deficient individuals experience a loss of appetite that can be restored with iron supplementation. It has been proposed that iron influences the satiety hormone leptin; however, a direct link between iron and leptin has remained elusive.

Takedown request   |   View complete answer on pmc.ncbi.nlm.nih.gov

What do you crave if your iron is low?

The term "pica" describes craving and chewing substances that have no nutritional value — such as ice, clay, soil or paper. Craving and chewing ice, known as pagophagia, is often associated with iron deficiency, with or without anemia, although the reason is unclear.

Takedown request   |   View complete answer on mayoclinic.org

What are the mental symptoms of low iron?

Anemia due to iron deficiency is a highly prevalent medical condition in women and children. Iron deficiency presents with fatigue, low mood, anxiety, restlessness, palpitations, and headache. Poor nutritional intake can be the reason of iron deficiency in underprivileged populations.

Takedown request   |   View complete answer on pmc.ncbi.nlm.nih.gov

What cancers cause low iron?

As a result, patients with leukemia often experience low hemoglobin levels. Additionally, leukemia cells use a lot of iron to support their rapid growth, which can lead to iron deficiency. Lymphoma Lymphoma, which includes both Hodgkin lymphoma and non-Hodgkin lymphoma, is a cancer that starts in the lymphatic system.

Takedown request   |   View complete answer on everydayhealth.com

What blocks iron absorption?

Inhibitors of iron absorption include phytate, which is a compound found in plant-based diets that demonstrate a dose-dependent effect on iron absorption. Polyphenols are found in black and herbal tea, coffee, wine, legumes, cereals, fruit, and vegetables and have been demonstrated to inhibit iron absorption.

Takedown request   |   View complete answer on ncbi.nlm.nih.gov

How long does it take to correct iron deficiency?

It is important to emphasize that in patients with iron deficiency anemia, iron will need to be given for a prolonged period of time. It generally takes 2–3 months for the hemoglobin level to return to normal level.

Takedown request   |   View complete answer on gastrojournal.org

What to avoid when taking iron pills?

When taking iron supplements, avoid pairing them with calcium, dairy, antacids, caffeine (coffee, tea, cola), high-fiber foods, and certain medications like some antibiotics, thyroid drugs, or Parkinson's meds, as they significantly reduce iron absorption; instead, take iron with Vitamin C (like orange juice) for better absorption, spacing other items by at least 2 hours, advises MedlinePlus, GoodRx, and Cleveland Clinic.
 

Takedown request   |   View complete answer on health.qld.gov.au

Can iron deficiency cause hair loss?

Iron deficiency can cause hair loss and increased hair shedding. Hair loss from low iron isn't permanent. Your hair will start to grow back once your iron levels return to normal. Oral iron supplements can help get your iron levels back to normal.

Takedown request   |   View complete answer on goodrx.com

What drinks improve iron absorption?

Making drinks and smoothies with iron-rich foods, like spinach, kale, and prunes can increase a person's iron intake. Vitamin C sources, such as orange and kiwi fruit juices can also benefit iron absorption. Red blood cells contain an iron-rich protein called hemoglobin.

Takedown request   |   View complete answer on medicalnewstoday.com

What is a red flag for anemia?

Warning signs of anemia you shouldn't ignore

Persistent fatigue. Weakness. Dizziness. Shortness of breath.

Takedown request   |   View complete answer on primarycarewalkinmedicalclinic.com

Do people with anemia sleep a lot?

Research suggests that having anemia tends to make people sleep less, not more. The tendency to sleep less is associated with both iron-deficiency anemia and non-iron-deficiency anemia and has been found to occur in people of all ages, including infants, children, adults, and older adults.

Takedown request   |   View complete answer on sleepfoundation.org

Can low iron cause joint pain?

Furthermore, headache and muscle and joint pain associated with iron deficiency are repeatedly considered migraine and fibromyalgia syndrome, respectively 3, 19. The multitude of symptoms is commonly associated low ferritin concentration without anemia 1, 17, 20, 21, 22.

Takedown request   |   View complete answer on pmc.ncbi.nlm.nih.gov